German Politics and British Politics (Classic Reprint)

Download German Politics and British Politics (Classic Reprint) PDF Online Free

Author :
Publisher :
ISBN 13 : 9780259833260
Total Pages : 40 pages
Book Rating : 4.8/5 (332 download)

DOWNLOAD NOW!


Book Synopsis German Politics and British Politics (Classic Reprint) by : James Cappon

Download or read book German Politics and British Politics (Classic Reprint) written by James Cappon and published by . This book was released on 2017-05-21 with total page 40 pages. Available in PDF, EPUB and Kindle. Book excerpt: Excerpt from German Politics and British PoliticsAfter having declared thus clearly and emphatically his policy with regard to the conflicting interests of Austria and Russia, he made the briefest reference to Germany's relations with Italy and England, which he declared were of so friendly a nature that they need not be taken at all into consideration in discussing the military question.' Then Bismarck came to the pith of 'his speech, the relations of Germany and France. It was in these, he said, that the real necessity for the strength ehing of the army lay. He was of opinion, he said, that the historic process - so he called it euphemistically - Which had gone on for 300 years between France and them was not ended and that they must be prepared to see it continued from the French side. They were now in possession of the object of contention (alsace Lorraine). They had no. Reason to fight.About the PublisherForgotten Books publishes hundreds of thousands of rare and classic books. Find more at www.forgottenbooks.comThis book is a reproduction of an important historical work. Forgotten Books uses state-of-the-art technology to digitally reconstruct the work, preserving the original format whilst repairing imperfections present in the aged copy. In rare cases, an imperfection in the original, such as a blemish or missing page, may be replicated in our edition. We do, however, repair the vast majority of imperfections successfully; any imperfections that remain are intentionally left to preserve the state of such historical works.

England Its Political Organization and Development and the War Against Germany (Classic Reprint)

Download England Its Political Organization and Development and the War Against Germany (Classic Reprint) PDF Online Free

Author :
Publisher : Forgotten Books
ISBN 13 : 9781330520772
Total Pages : 358 pages
Book Rating : 4.5/5 (27 download)

DOWNLOAD NOW!


Book Synopsis England Its Political Organization and Development and the War Against Germany (Classic Reprint) by : Eduard Meyer

Download or read book England Its Political Organization and Development and the War Against Germany (Classic Reprint) written by Eduard Meyer and published by Forgotten Books. This book was released on 2015-06-30 with total page 358 pages. Available in PDF, EPUB and Kindle. Book excerpt: Excerpt from England Its Political Organization and Development and the War Against Germany IN offering this book to an English speaking public we feel assured that its contents will prove of value to the open-minded reader who desires an all round knowledge of the absorbing topic of the day, - the great war and the causes that led up to it. The author is a highly distinguished historian who, in undertaking this work, departs from his previous and chosen field of ancient history to discuss his present subject with engaging frankness. Concisely and clearly he places before the reader the part that England has played in history, especially in regard to the relations that the English' have borne to the other nations of the world. The ripe judgment and keen insight of the thorough student of history and of world politics gives the book the claim to be the most reasonable, accurate and far seeing work that has as yet been offered to the public with regard to the development and character of the English people, as viewed from the German standpoint. About the Publisher Forgotten Books publishes hundreds of thousands of rare and classic books. Find more at www.forgottenbooks.com This book is a reproduction of an important historical work. Forgotten Books uses state-of-the-art technology to digitally reconstruct the work, preserving the original format whilst repairing imperfections present in the aged copy. In rare cases, an imperfection in the original, such as a blemish or missing page, may be replicated in our edition. We do, however, repair the vast majority of imperfections successfully; any imperfections that remain are intentionally left to preserve the state of such historical works.

German Politics and British Politics [microform]

Download German Politics and British Politics [microform] PDF Online Free

Author :
Publisher : Legare Street Press
ISBN 13 : 9781014954787
Total Pages : 46 pages
Book Rating : 4.9/5 (547 download)

DOWNLOAD NOW!


Book Synopsis German Politics and British Politics [microform] by : James 1855-1939 Cappon

Download or read book German Politics and British Politics [microform] written by James 1855-1939 Cappon and published by Legare Street Press. This book was released on 2021-09-10 with total page 46 pages. Available in PDF, EPUB and Kindle. Book excerpt: This work has been selected by scholars as being culturally important and is part of the knowledge base of civilization as we know it. This work is in the public domain in the United States of America, and possibly other nations. Within the United States, you may freely copy and distribute this work, as no entity (individual or corporate) has a copyright on the body of the work. Scholars believe, and we concur, that this work is important enough to be preserved, reproduced, and made generally available to the public. To ensure a quality reading experience, this work has been proofread and republished using a format that seamlessly blends the original graphical elements with text in an easy-to-read typeface. We appreciate your support of the preservation process, and thank you for being an important part of keeping this knowledge alive and relevant.

Britain as Germany's Vassal (Classic Reprint)

Download Britain as Germany's Vassal (Classic Reprint) PDF Online Free

Author :
Publisher :
ISBN 13 : 9781330847589
Total Pages : 262 pages
Book Rating : 4.8/5 (475 download)

DOWNLOAD NOW!


Book Synopsis Britain as Germany's Vassal (Classic Reprint) by : General Friedrich von Bernhardi

Download or read book Britain as Germany's Vassal (Classic Reprint) written by General Friedrich von Bernhardi and published by . This book was released on 2015-07-07 with total page 262 pages. Available in PDF, EPUB and Kindle. Book excerpt: Excerpt from Britain as Germany's Vassal He urges the necessity of an attack upon the Entente Powers, although it "may certainly lead to a war similar to the 'Seven Years War'" (see last chapter). The war should be made to arise out of the Balkan question. Then England might perhaps not join in (see last chapter). Turkey should attack Russia in the South and Britain in Egypt (Chapter X). Diplomatically and militarily Germany has carried out every one of Bernhardi's recommendations contained in the present volume. His latest book is perhaps the most remarkable political indiscretion of modern times. It is, besides, a paean of war and of German civilisation. The word "Kultur" occurs three or four times on most pages, and seven or eight times on several. As the question has been discussed whether Germany has, or has not, observed the laws and rules of civilised warfare, I have appended a few extracts from the regulations adopted at the Hague Conference of 1907 to which Germany has subscribed, and from "Kriegsbrauch im Landkriege," the authoritative German handbook on the customs of war published by the German General Staff in 1902. I would draw particular attention to their great importance. They will enable every reader to form for himself an opinion as to the character and legality of Germany's actions based on the highest international and German authorities. About the Publisher Forgotten Books publishes hundreds of thousands of rare and classic books. Find more at www.forgottenbooks.com This book is a reproduction of an important historical work. Forgotten Books uses state-of-the-art technology to digitally reconstruct the work, preserving the original format whilst repairing imperfections present in the aged copy. In rare cases, an imperfection in the original, such as a blemish or missing page, may be replicated in our edition. We do, however, repair the vast majority of imperfections successfully; any imperfections that remain are intentionally left to preserve the state of such historical works.

Forty Years of German-American Political Relations (Classic Reprint)

Download Forty Years of German-American Political Relations (Classic Reprint) PDF Online Free

Author :
Publisher : Forgotten Books
ISBN 13 : 9781333435905
Total Pages : 382 pages
Book Rating : 4.4/5 (359 download)

DOWNLOAD NOW!


Book Synopsis Forty Years of German-American Political Relations (Classic Reprint) by : Jeannette Keim

Download or read book Forty Years of German-American Political Relations (Classic Reprint) written by Jeannette Keim and published by Forgotten Books. This book was released on 2016-09-02 with total page 382 pages. Available in PDF, EPUB and Kindle. Book excerpt: Excerpt from Forty Years of German-American Political Relations F. R. Foreign Relations of the United States (u. S. Diplomatic correspondence with foreign countries). About the Publisher Forgotten Books publishes hundreds of thousands of rare and classic books. Find more at www.forgottenbooks.com This book is a reproduction of an important historical work. Forgotten Books uses state-of-the-art technology to digitally reconstruct the work, preserving the original format whilst repairing imperfections present in the aged copy. In rare cases, an imperfection in the original, such as a blemish or missing page, may be replicated in our edition. We do, however, repair the vast majority of imperfections successfully; any imperfections that remain are intentionally left to preserve the state of such historical works.

England, Germany and Europe (Classic Reprint)

Download England, Germany and Europe (Classic Reprint) PDF Online Free

Author :
Publisher : Forgotten Books
ISBN 13 : 9780331878202
Total Pages : 30 pages
Book Rating : 4.8/5 (782 download)

DOWNLOAD NOW!


Book Synopsis England, Germany and Europe (Classic Reprint) by : James Wycliffe Headlam

Download or read book England, Germany and Europe (Classic Reprint) written by James Wycliffe Headlam and published by Forgotten Books. This book was released on 2017-11-24 with total page 30 pages. Available in PDF, EPUB and Kindle. Book excerpt: Excerpt from England, Germany and Europe Never has there been so sudden a change in the complexion Of a nation as that which took place among us during the first days of August. One week we saw nothing but confusion, irresolution, pro crastination; party spirit enraged to an unknown degree the very foundations of the State undermined, the House of Commons, which is the mainspring in our institutions lamed, civil war imminent. For the first time within the memory of man the authority Of Parliament was Openly challenged by men in arms. The discipline of the Army had become a question of party politics and men threatened to throw into the cauldron the Crown itself. Look where one would there was no escape, no solution of the unprecedented entanglement. A few days passed and the voice of faction was dead the two Houses of Parliament'at harmony within and united with each other showed themselves to be representatives of a united nation, and for the first time since the death of Pitt we heard from the Treasury Bench in clarion tones the authentic voice of England. About the Publisher Forgotten Books publishes hundreds of thousands of rare and classic books. Find more at www.forgottenbooks.com This book is a reproduction of an important historical work. Forgotten Books uses state-of-the-art technology to digitally reconstruct the work, preserving the original format whilst repairing imperfections present in the aged copy. In rare cases, an imperfection in the original, such as a blemish or missing page, may be replicated in our edition. We do, however, repair the vast majority of imperfections successfully; any imperfections that remain are intentionally left to preserve the state of such historical works.

The War Spirit of Germany (Classic Reprint)

Download The War Spirit of Germany (Classic Reprint) PDF Online Free

Author :
Publisher : Forgotten Books
ISBN 13 : 9780267596607
Total Pages : 30 pages
Book Rating : 4.5/5 (966 download)

DOWNLOAD NOW!


Book Synopsis The War Spirit of Germany (Classic Reprint) by : George Mckinnon Wrong

Download or read book The War Spirit of Germany (Classic Reprint) written by George Mckinnon Wrong and published by Forgotten Books. This book was released on 2018-02-02 with total page 30 pages. Available in PDF, EPUB and Kindle. Book excerpt: Excerpt from The War Spirit of Germany This backwardness in political thought and action constitutes one of the tragedies of the history of Germany. 'in political development Germany is where England stood in the days of Elizabeth. Un der Elizabeth, Parliament played but a small part in the life of the nation. True, it met, though sometimes only at intervals of several years, and it had control of the purse and of the making of new laws. But it voted revenues that the sovereign retained through life without further appeal to Parliament, and, since the sovereign usually thought there were already laws enough and desired little change, no new ones were passed for many years at a time. For the rest, the sovereign and the circle surrounding her controlled and spent the revenue; she named whom she would to office, kept up the army and navy, and resisted any attempt by the representatives of the nation to interfere in these things. W'ith slight differences the German Emperor does the same thing to-day. The German people have no more control over the government of Germany than the English people had over that of England in the long distant days before the struggle with Charles I to secure what Elizabeth had always refused to yield. About the Publisher Forgotten Books publishes hundreds of thousands of rare and classic books. Find more at www.forgottenbooks.com This book is a reproduction of an important historical work. Forgotten Books uses state-of-the-art technology to digitally reconstruct the work, preserving the original format whilst repairing imperfections present in the aged copy. In rare cases, an imperfection in the original, such as a blemish or missing page, may be replicated in our edition. We do, however, repair the vast majority of imperfections successfully; any imperfections that remain are intentionally left to preserve the state of such historical works.

The Foreign Policy of Sir Edward Grey 1906-1915 (Classic Reprint)

Download The Foreign Policy of Sir Edward Grey 1906-1915 (Classic Reprint) PDF Online Free

Author :
Publisher :
ISBN 13 : 9781331020240
Total Pages : 132 pages
Book Rating : 4.0/5 (22 download)

DOWNLOAD NOW!


Book Synopsis The Foreign Policy of Sir Edward Grey 1906-1915 (Classic Reprint) by : Gilbert Murray

Download or read book The Foreign Policy of Sir Edward Grey 1906-1915 (Classic Reprint) written by Gilbert Murray and published by . This book was released on 2015-07-09 with total page 132 pages. Available in PDF, EPUB and Kindle. Book excerpt: Excerpt from The Foreign Policy of Sir Edward Grey 1906-1915 It is a characteristic of British politics that, even in times of crisis, there are always men to be found who will criticize severely their country's action and expound sympathetically the case for their country's enemies. I think we may well be proud of this characteristic. It is one that could only be found in a community which is highly civilized; whose heart is set on honourable dealing and not merely on success, and whose citizens in general trust one another and are free from panic. For these few who protest are not traitors, and no sensible person ever thinks they are. They may be right or wrong on the main issue; their motives may vary from the purest love of justice to divers degrees of prejudice or pigheadedness or personal pique. But they are never guilty, and never seriously suspected, of either treachery or corruption. No government ever persecutes them. No mob seriously maltreats them. They are unpopular, but nothing more. And certainly the present writer would be among the very last to judge any one harshly for being 'the friend of every country but his own.' He has too often been called that name himself, and has been proud of it. He is not going to blame any one for being 'pro-German' in the only sense in which the term can be fairly used; that is, of being anxious to state the case for Germany as clearly and fairly as possible, and to help us to understand our enemies. In the other sense, in the sense of wishing the Germans to win the war, there are, I believe, no pro-Germans among the sane inhabitants of Great Britain. About the Publisher Forgotten Books publishes hundreds of thousands of rare and classic books. Find more at www.forgottenbooks.com This book is a reproduction of an important historical work. Forgotten Books uses state-of-the-art technology to digitally reconstruct the work, preserving the original format whilst repairing imperfections present in the aged copy. In rare cases, an imperfection in the original, such as a blemish or missing page, may be replicated in our edition. We do, however, repair the vast majority of imperfections successfully; any imperfections that remain are intentionally left to preserve the state of such historical works.

The War and the British Dominions (Classic Reprint)

Download The War and the British Dominions (Classic Reprint) PDF Online Free

Author :
Publisher : Forgotten Books
ISBN 13 : 9780332412146
Total Pages : 32 pages
Book Rating : 4.4/5 (121 download)

DOWNLOAD NOW!


Book Synopsis The War and the British Dominions (Classic Reprint) by : H. E. Egehton

Download or read book The War and the British Dominions (Classic Reprint) written by H. E. Egehton and published by Forgotten Books. This book was released on 2017-12-04 with total page 32 pages. Available in PDF, EPUB and Kindle. Book excerpt: Excerpt from The War and the British Dominions Germany. And, in this state of things, what would be the position of the British Dominions? It is improbable that Germany would desire at once to annex them as portions of her Empire. She would probably, at first, be content to put pressure to hear so that they should sever their political connexion with Great Britain; and then would attempt to obtain the monopoly of their trade by enforcing preferential treatment. Were emigration from Germany again to become necessary or expedient, the emigrants would be encouraged to go to Canada or Australasia; by which means the German element in these communities would be strengthened. Meanwhile, in various directions the emissaries of German 'culture' would be spreading their nets. Elsewhere German action might be more direct. According to the summary of his speech telegraphed to England, General Smuts has recently stated that there is evidence in the hands of the South African Union Government of German intrigues against British South Africa. It is impossible for as here to know the character of such evidence but we all remember the exultant message which the German Kaiser dispatched on receiving the news of the foolish fiasco of the Jameson raid. It showed better than reams of commentary how close was the attention being paid by Queen Victoria's august grandson to the possibilities of trouble for the British Empire. Happily for Great Britain, 'by a certain divine good fortune the members of the German governing classes excel in offending those whom it. Is their interest to conciliate. Thus, after the treaty of Vereeniging, Transvaal farmeis trekked into German south-west Africa to escape the humiliation of British rule. Most of them, however, soon found their way back, recognizing that the whipcords of British dominion were far lighter than the scorpions of German authority. Similarly, if. About the Publisher Forgotten Books publishes hundreds of thousands of rare and classic books. Find more at www.forgottenbooks.com This book is a reproduction of an important historical work. Forgotten Books uses state-of-the-art technology to digitally reconstruct the work, preserving the original format whilst repairing imperfections present in the aged copy. In rare cases, an imperfection in the original, such as a blemish or missing page, may be replicated in our edition. We do, however, repair the vast majority of imperfections successfully; any imperfections that remain are intentionally left to preserve the state of such historical works.

Municipal Life and Government in Germany (Classic Reprint)

Download Municipal Life and Government in Germany (Classic Reprint) PDF Online Free

Author :
Publisher : Forgotten Books
ISBN 13 : 9781331365273
Total Pages : 524 pages
Book Rating : 4.3/5 (652 download)

DOWNLOAD NOW!


Book Synopsis Municipal Life and Government in Germany (Classic Reprint) by : William Harbutt Dawson

Download or read book Municipal Life and Government in Germany (Classic Reprint) written by William Harbutt Dawson and published by Forgotten Books. This book was released on 2015-07-14 with total page 524 pages. Available in PDF, EPUB and Kindle. Book excerpt: Excerpt from Municipal Life and Government in Germany The completion of this book realises a long-cherished wish and intention the fulfilment of which, owing to many reasons, has repeatedly been deferred. In various writings on German life and institutions, now covering a period of just twenty-five years, I have touched upon isolated aspects of the subject of municipal government. Now, for the first time, I have the satisfaction of dealing with the subject systematically, and so of giving to it, as I trust, a treatment worthier of its importance. The actual work of writing has been spread over four years. The book, as its title explains, is concerned solely with questions of urban administration, yet without the limitation which the use of the word "municipal" might seem to suggest. The larger German cities and towns correspond for all practical purposes to the municipalities of the United Kingdom, as the smaller German towns correspond to our urban districts; hence it has appeared to me justifiable to consider convenience rather than strict historical and technical accuracy in the use of the terms "municipality" and "municipal," and to follow common wont in applying these terms to urban organisations, institutions, and activities generally, irrespective of the question of incorporation as understood in this country. On the subject of sources, a special remark needs to be made. This is not a book written from books, though German literature has, of course, been freely used. About the Publisher Forgotten Books publishes hundreds of thousands of rare and classic books. Find more at www.forgottenbooks.com This book is a reproduction of an important historical work. Forgotten Books uses state-of-the-art technology to digitally reconstruct the work, preserving the original format whilst repairing imperfections present in the aged copy. In rare cases, an imperfection in the original, such as a blemish or missing page, may be replicated in our edition. We do, however, repair the vast majority of imperfections successfully; any imperfections that remain are intentionally left to preserve the state of such historical works.

The University of Chicago War Papers, Vol. 1

Download The University of Chicago War Papers, Vol. 1 PDF Online Free

Author :
Publisher : Forgotten Books
ISBN 13 : 9780267995479
Total Pages : 34 pages
Book Rating : 4.9/5 (954 download)

DOWNLOAD NOW!


Book Synopsis The University of Chicago War Papers, Vol. 1 by : Harry Pratt Judson

Download or read book The University of Chicago War Papers, Vol. 1 written by Harry Pratt Judson and published by Forgotten Books. This book was released on 2018-02-07 with total page 34 pages. Available in PDF, EPUB and Kindle. Book excerpt: Excerpt from The University of Chicago War Papers, Vol. 1: The Threat of German World-Politics The joint resolution adopted by Congress in April, 1917, declared a state of war to exist with Germany. Eighteen American ships had already been sunk by German attacks, and two hundred thirty-seven Americans had been killed. The attacks were not only on vessels of the United States. Piratical raids were uniformly aimed at everybody. One-third of the Norwegian commercial marine had been destroyed. In May, 1915, the Lusitania, a passenger ship, was sunk without warning, without giving any Chance for the safety of those on board. More than one thousand persons were drowned. Over one hundred of these were Americans, many of them women and little Children. In these German attacks on neutral rights and safety there was no remote resemblance to the acts of the British navy. While it is true that American commerce with Germany was hindered and in a large measure prevented by the British naval blockade, at the same time not one American life had been lost, not one American ship had been destroyed. It was wholly a matter Of property. Each claim on the British govern ment resulting from the blockade could be settled by courts of law, and damages could be paid in money. The only immediate effect on Ameri can prosperity was perhaps that the profits Oi American business might be double rather than threefold what they had been before the war. Further, the question as to the unlawfulness of the British blockade at best was in doubt. Very likely a suit before a court of arbitration on that ground would have gone against the United States. About the Publisher Forgotten Books publishes hundreds of thousands of rare and classic books. Find more at www.forgottenbooks.com This book is a reproduction of an important historical work. Forgotten Books uses state-of-the-art technology to digitally reconstruct the work, preserving the original format whilst repairing imperfections present in the aged copy. In rare cases, an imperfection in the original, such as a blemish or missing page, may be replicated in our edition. We do, however, repair the vast majority of imperfections successfully; any imperfections that remain are intentionally left to preserve the state of such historical works.

Comparative View of the Executive and Legislative Departments of the Government of the United States, France, England, and Germany (Classic Reprint)

Download Comparative View of the Executive and Legislative Departments of the Government of the United States, France, England, and Germany (Classic Reprint) PDF Online Free

Author :
Publisher : Forgotten Books
ISBN 13 : 9780266275961
Total Pages : 34 pages
Book Rating : 4.2/5 (759 download)

DOWNLOAD NOW!


Book Synopsis Comparative View of the Executive and Legislative Departments of the Government of the United States, France, England, and Germany (Classic Reprint) by : John Wenzel

Download or read book Comparative View of the Executive and Legislative Departments of the Government of the United States, France, England, and Germany (Classic Reprint) written by John Wenzel and published by Forgotten Books. This book was released on 2017-11 with total page 34 pages. Available in PDF, EPUB and Kindle. Book excerpt: Excerpt from Comparative View of the Executive and Legislative Departments of the Government of the United States, France, England, and Germany Taniduofamngmgoutfinaofthegovemmmmdtheunimdsmmcc, enghnd, md Germanyinpamllelcolumnsthatcomparison mightbemmmadflymadqwassnggestedwhile reading Proicssor Woodrow Wilson's work on historical and practical politics, entitled The State. Itwaswiththeaidofthisandanumberofotherworksthmmecmmmvowgov. About the Publisher Forgotten Books publishes hundreds of thousands of rare and classic books. Find more at www.forgottenbooks.com This book is a reproduction of an important historical work. Forgotten Books uses state-of-the-art technology to digitally reconstruct the work, preserving the original format whilst repairing imperfections present in the aged copy. In rare cases, an imperfection in the original, such as a blemish or missing page, may be replicated in our edition. We do, however, repair the vast majority of imperfections successfully; any imperfections that remain are intentionally left to preserve the state of such historical works.

The Oxford Handbook of Modern German History

Download The Oxford Handbook of Modern German History PDF Online Free

Author :
Publisher : Oxford University Press
ISBN 13 : 0191617458
Total Pages : 882 pages
Book Rating : 4.1/5 (916 download)

DOWNLOAD NOW!


Book Synopsis The Oxford Handbook of Modern German History by : Helmut Walser Smith

Download or read book The Oxford Handbook of Modern German History written by Helmut Walser Smith and published by Oxford University Press. This book was released on 2011-09-29 with total page 882 pages. Available in PDF, EPUB and Kindle. Book excerpt: This is the first comprehensive, multi-author survey of German history that features cutting-edge syntheses of major topics by an international team of leading scholars. Emphasizing demographic, economic, and political history, this Handbook places German history in a denser transnational context than any other general history of Germany. It underscores the centrality of war to the unfolding of German history, and shows how it dramatically affected the development of German nationalism and the structure of German politics. It also reaches out to scholars and students beyond the field of history with detailed and cutting-edge chapters on religious history and on literary history, as well as to contemporary observers, with reflections on Germany and the European Union, and on 'multi-cultural Germany'. Covering the period from around 1760 to the present, this Handbook represents a remarkable achievement of synthesis based on current scholarship. It constitutes the starting point for anyone trying to understand the complexities of German history as well as the state of scholarly reflection on Germany's dramatic, often destructive, integration into the community of modern nations. As it brings this story to the present, it also places the current post-unification Federal Republic of Germany into a multifaceted historical context. It will be an indispensable resource for scholars, students, and anyone interested in modern Germany.

Two War Years in Constantinople

Download Two War Years in Constantinople PDF Online Free

Author :
Publisher : Forgotten Books
ISBN 13 : 9780260780508
Total Pages : 300 pages
Book Rating : 4.7/5 (85 download)

DOWNLOAD NOW!


Book Synopsis Two War Years in Constantinople by : Harry Stuermer

Download or read book Two War Years in Constantinople written by Harry Stuermer and published by Forgotten Books. This book was released on 2017-12-02 with total page 300 pages. Available in PDF, EPUB and Kindle. Book excerpt: Excerpt from Two War Years in Constantinople: Sketches of German and Young Turkish Ethics and Politics Several months have passed since the orig inal text Of the German and French editions of this little book was written. Baghdad was taken by British troops before the last chapter of the German manuscript had been completed, and since then military operations have been more and more in favour of the Entente. A number of important political events have occurred, such as the Russian Rev olution and the entry of the United States Of America into the war. About the Publisher Forgotten Books publishes hundreds of thousands of rare and classic books. Find more at www.forgottenbooks.com This book is a reproduction of an important historical work. Forgotten Books uses state-of-the-art technology to digitally reconstruct the work, preserving the original format whilst repairing imperfections present in the aged copy. In rare cases, an imperfection in the original, such as a blemish or missing page, may be replicated in our edition. We do, however, repair the vast majority of imperfections successfully; any imperfections that remain are intentionally left to preserve the state of such historical works.

The Rise of Political Anti-semitism in Germany & Austria

Download The Rise of Political Anti-semitism in Germany & Austria PDF Online Free

Author :
Publisher : Harvard University Press
ISBN 13 : 9780674771666
Total Pages : 388 pages
Book Rating : 4.7/5 (716 download)

DOWNLOAD NOW!


Book Synopsis The Rise of Political Anti-semitism in Germany & Austria by : Peter G. J. Pulzer

Download or read book The Rise of Political Anti-semitism in Germany & Austria written by Peter G. J. Pulzer and published by Harvard University Press. This book was released on 1988 with total page 388 pages. Available in PDF, EPUB and Kindle. Book excerpt: To understand the 20th century, we must know the 19th. It was then that an ancient prejudice was forged into a modern political weapon. How and why this happened is shown in this classic study by Peter Pulzer, first published in 1964 and now reprinted with a new Introduction by the author.

The Last Battle

Download The Last Battle PDF Online Free

Author :
Publisher : Simon and Schuster
ISBN 13 : 1439127018
Total Pages : 749 pages
Book Rating : 4.4/5 (391 download)

DOWNLOAD NOW!


Book Synopsis The Last Battle by : Cornelius Ryan

Download or read book The Last Battle written by Cornelius Ryan and published by Simon and Schuster. This book was released on 2010-02-16 with total page 749 pages. Available in PDF, EPUB and Kindle. Book excerpt: The classic account of the final offensive against Hitler’s Third Reich. The Battle for Berlin was the culminating struggle of World War II in the European theater, the last offensive against Hitler’s Third Reich, which devastated one of Europe’s historic capitals and marked the final defeat of Nazi Germany. It was also one of the war’s bloodiest and most pivotal battles, whose outcome would shape international politics for decades to come. The Last Battle is Cornelius Ryan’s compelling account of this final battle, a story of brutal extremes, of stunning military triumph alongside the stark conditions that the civilians of Berlin experienced in the face of the Allied assault. As always, Ryan delves beneath the military and political forces that were dictating events to explore the more immediate imperatives of survival, where, as the author describes it, “to eat had become more important than to love, to burrow more dignified than to fight, to exist more militarily correct than to win.” The Last Battle is the story of ordinary people, both soldiers and civilians, caught up in the despair, frustration, and terror of defeat. It is history at its best, a masterful illumination of the effects of war on the lives of individuals, and one of the enduring works on World War II.

Retooling Politics

Download Retooling Politics PDF Online Free

Author :
Publisher : Cambridge University Press
ISBN 13 : 1108419402
Total Pages : 337 pages
Book Rating : 4.1/5 (84 download)

DOWNLOAD NOW!


Book Synopsis Retooling Politics by : Andreas Jungherr

Download or read book Retooling Politics written by Andreas Jungherr and published by Cambridge University Press. This book was released on 2020-06-11 with total page 337 pages. Available in PDF, EPUB and Kindle. Book excerpt: Provides academics, journalists, and general readers with bird's-eye view of data-driven practices and their impact in politics and media.